| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries) |
| Domain d2fb4l2: 2fb4 L:110-214 [20950] Other proteins in same PDB: d2fb4h1, d2fb4h2, d2fb4l1 part of Fab KOL |
PDB Entry: 2fb4 (more details), 1.9 Å
SCOPe Domain Sequences for d2fb4l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fb4l2 b.1.1.2 (L:110-214) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d2fb4l2: