Lineage for d2fb4l2 (2fb4 L:110-214)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries) 
Domain d2fb4l2: 2fb4 L:110-214 [20950]
Other proteins in same PDB: d2fb4h1, d2fb4h2, d2fb4l1
part of Fab KOL
Details for d2fb4l2
PDB Entry: 2fb4 (more details), 1.9 Å
PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda-typ, subgruppe i (german)
PDB Compounds: (L:) igg1-lambda kol fab (light chain)SCOPe Domain Sequences for d2fb4l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fb4l2 b.1.1.2 (L:110-214) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
SCOPe Domain Coordinates for d2fb4l2:
Click to download the PDB-style file with coordinates for d2fb4l2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fb4l2:
- d2fb4l2 first appeared (with stable ids) in SCOP 1.55
- d2fb4l2 appears in SCOPe 2.07
View in 3D
