Lineage for d1ak4b_ (1ak4 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806648Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2806663Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (136 PDB entries)
    Uniprot P05092
  8. 2806796Domain d1ak4b_: 1ak4 B: [27473]
    Other proteins in same PDB: d1ak4c_, d1ak4d_

Details for d1ak4b_

PDB Entry: 1ak4 (more details), 2.36 Å

PDB Description: human cyclophilin a bound to the amino-terminal domain of hiv-1 capsid
PDB Compounds: (B:) cyclophilin a

SCOPe Domain Sequences for d1ak4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ak4b_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
nptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfmc
qggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktewl
dgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d1ak4b_:

Click to download the PDB-style file with coordinates for d1ak4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ak4b_: