SCOPe 2.06: Domain d5aiue_: 5aiu E:

Lineage for d5aiue_ (5aiu E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (46 PDB entries)

8. Domain d5aiue_: 5aiu E: [274675]
   Other proteins in same PDB: d5aiuc_, d5aiuf_
   automated match to d3w31b_
   complexed with edo, zn

Details for d5aiue_

PDB Entry: 5aiu, 2.21 Å

PDB Description: a complex of rnf4-ring domain, ubc13-ub (isopeptide crosslink)

PDB Compounds: (E:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d5aiue_:

Sequence; same for both SEQRES and ATOM records:

>d5aiue_ d.20.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgrikldiladkwspalqirtvllsiqallsapnpddpl
andvaeqwktneaqaietarawtrlyamnn

Timeline for d5aiue_:

• d5aiue_ first appeared in SCOPe 2.05
  
• d5aiue_ is called d5aiue1 in SCOPe 2.07
  
• d5aiue_ appears in the current release, SCOPe 2.08, called d5aiue1