Lineage for d5aiue1 (5aiu E:4-151)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2507730Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2507955Protein automated matches [190124] (12 species)
    not a true protein
  7. 2507970Species Human (Homo sapiens) [TaxId:9606] [186848] (41 PDB entries)
  8. 2508022Domain d5aiue1: 5aiu E:4-151 [274675]
    Other proteins in same PDB: d5aiub2, d5aiuc_, d5aiue2, d5aiuf_
    automated match to d3w31b_
    complexed with edo, zn

Details for d5aiue1

PDB Entry: 5aiu (more details), 2.21 Å

PDB Description: a complex of rnf4-ring domain, ubc13-ub (isopeptide crosslink)
PDB Compounds: (E:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d5aiue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aiue1 d.20.1.1 (E:4-151) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
maapkvrfmtkiyhpnvdklgrikldiladkwspalqirtvllsiqallsapnpddplan
dvaeqwktneaqaietarawtrlyamnn

SCOPe Domain Coordinates for d5aiue1:

Click to download the PDB-style file with coordinates for d5aiue1.
(The format of our PDB-style files is described here.)

Timeline for d5aiue1: