Lineage for d1vbta_ (1vbt A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232982Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 232983Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 232984Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 232990Protein Cyclophilin (eukaryotic) [50893] (8 species)
  7. 232999Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (35 PDB entries)
  8. 233042Domain d1vbta_: 1vbt A: [27462]

Details for d1vbta_

PDB Entry: 1vbt (more details), 2.3 Å

PDB Description: Structure of cyclophilin complexed with sulfur-substituted tetrapeptide AAPF

SCOP Domain Sequences for d1vbta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbta_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1vbta_:

Click to download the PDB-style file with coordinates for d1vbta_.
(The format of our PDB-style files is described here.)

Timeline for d1vbta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vbtb_