SCOPe 2.07: Domain d5bxqe_: 5bxq E:

Lineage for d5bxqe_ (5bxq E:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [52610] (9 PDB entries)
   Uniprot P62825

8. Domain d5bxqe_: 5bxq E: [274454]
   Other proteins in same PDB: d5bxqa_, d5bxqb_
   automated match to d1a2ke_
   complexed with gdp, mg, so4

Details for d5bxqe_

PDB Entry: 5bxq, 2.5 Å

PDB Description: structure of the ntf2:rangdp complex

PDB Compounds: (E:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d5bxqe_:

Sequence, based on SEQRES records:

>d5bxqe_ c.37.1.8 (E:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqttalpde

Sequence, based on observed residues (ATOM records):

>d5bxqe_ c.37.1.8 (E:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrnlqyydisaksnynfekpflwlarkligdpnlefvampalappevvm
dpalaaqyehdlevaqttalpde

Timeline for d5bxqe_:

• d5bxqe_ first appeared in SCOPe 2.05
  
• d5bxqe_ appears in SCOPe 2.06
  
• d5bxqe_ appears in the current release, SCOPe 2.08