SCOPe 2.07: Domain d4up1d_: 4up1 D:

Lineage for d4up1d_ (4up1 D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189245] (15 PDB entries)

8. Domain d4up1d_: 4up1 D: [274332]
   automated match to d4eb4a_
   complexed with so4

Details for d4up1d_

PDB Entry: 4up1, 2.99 Å

PDB Description: crystal structure of native human thymidylate synthase in active form

PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d4up1d_:

Sequence; same for both SEQRES and ATOM records:

>d4up1d_ d.117.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptik

Timeline for d4up1d_:

• d4up1d_ first appeared in SCOPe 2.05
  
• d4up1d_ appears in SCOPe 2.06
  
• d4up1d_ appears in the current release, SCOPe 2.08