Lineage for d4up1d_ (4up1 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972567Protein automated matches [190469] (17 species)
    not a true protein
  7. 2972632Species Human (Homo sapiens) [TaxId:9606] [189245] (10 PDB entries)
  8. 2972648Domain d4up1d_: 4up1 D: [274332]
    automated match to d4eb4a_
    complexed with so4

Details for d4up1d_

PDB Entry: 4up1 (more details), 2.99 Å

PDB Description: crystal structure of native human thymidylate synthase in active form
PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d4up1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4up1d_ d.117.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptik

SCOPe Domain Coordinates for d4up1d_:

Click to download the PDB-style file with coordinates for d4up1d_.
(The format of our PDB-style files is described here.)

Timeline for d4up1d_: