SCOPe 2.07: Domain d4uduc2: 4udu C:121-233

Lineage for d4uduc2 (4udu C:121-233)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225055] (9 PDB entries)

8. Domain d4uduc2: 4udu C:121-233 [274289]
   Other proteins in same PDB: d4udua1, d4udua2, d4udub1, d4udub2, d4uduc1
   automated match to d1esfa2
   complexed with na, zn

Details for d4uduc2

PDB Entry: 4udu, 2.5 Å

PDB Description: crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor

PDB Compounds: (C:) enterotoxin type e

SCOPe Domain Sequences for d4uduc2:

Sequence; same for both SEQRES and ATOM records:

>d4uduc2 d.15.6.0 (C:121-233) automated matches {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwidgkqttvpidkvktskkevtvqeldlqarhylhgkfglynsdsfggkvq
rglivfhssegstvsydlfdaqgqypdtllriyrdnktinsenlhidlylytt

Timeline for d4uduc2:

• d4uduc2 first appeared in SCOPe 2.05
  
• d4uduc2 appears in SCOPe 2.06
  
• d4uduc2 appears in the current release, SCOPe 2.08