![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
![]() | Protein automated matches [226841] (6 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [225055] (9 PDB entries) |
![]() | Domain d4uduc2: 4udu C:121-233 [274289] Other proteins in same PDB: d4udua1, d4udua2, d4udub1, d4udub2, d4uduc1 automated match to d1esfa2 complexed with na, zn |
PDB Entry: 4udu (more details), 2.5 Å
SCOPe Domain Sequences for d4uduc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uduc2 d.15.6.0 (C:121-233) automated matches {Staphylococcus aureus [TaxId: 1280]} eekkvpinlwidgkqttvpidkvktskkevtvqeldlqarhylhgkfglynsdsfggkvq rglivfhssegstvsydlfdaqgqypdtllriyrdnktinsenlhidlylytt
Timeline for d4uduc2:
![]() Domains from other chains: (mouse over for more information) d4udua1, d4udua2, d4udub1, d4udub2 |