Lineage for d4uduc2 (4udu C:121-233)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934586Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 2934587Protein automated matches [226841] (6 species)
    not a true protein
  7. 2934588Species Staphylococcus aureus [TaxId:1280] [225055] (9 PDB entries)
  8. 2934605Domain d4uduc2: 4udu C:121-233 [274289]
    Other proteins in same PDB: d4udua1, d4udua2, d4udub1, d4udub2, d4uduc1
    automated match to d1esfa2
    complexed with na, zn

Details for d4uduc2

PDB Entry: 4udu (more details), 2.5 Å

PDB Description: crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor
PDB Compounds: (C:) enterotoxin type e

SCOPe Domain Sequences for d4uduc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uduc2 d.15.6.0 (C:121-233) automated matches {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwidgkqttvpidkvktskkevtvqeldlqarhylhgkfglynsdsfggkvq
rglivfhssegstvsydlfdaqgqypdtllriyrdnktinsenlhidlylytt

SCOPe Domain Coordinates for d4uduc2:

Click to download the PDB-style file with coordinates for d4uduc2.
(The format of our PDB-style files is described here.)

Timeline for d4uduc2: