Lineage for d4r90l1 (4r90 L:3-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759475Species Llama glama [TaxId:9844] [271448] (2 PDB entries)
  8. 2759476Domain d4r90l1: 4r90 L:3-110 [274263]
    Other proteins in same PDB: d4r90h_, d4r90l2
    automated match to d3n9gl1
    complexed with ca, gol

Details for d4r90l1

PDB Entry: 4r90 (more details), 1.75 Å

PDB Description: anti cd70 llama glama fab 27b3
PDB Compounds: (L:) Anti CD70 Llama glama Fab 27B3 Light chain

SCOPe Domain Sequences for d4r90l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r90l1 b.1.1.0 (L:3-110) automated matches {Llama glama [TaxId: 9844]}
vvtqepsltvspggtvtltcglksgsvtstnfptwyqqtpgqaprlliyntntrhsgvps
rfsgsisenkaaltitgaqpedeaeyfcalfisnpsvefgggtqltvl

SCOPe Domain Coordinates for d4r90l1:

Click to download the PDB-style file with coordinates for d4r90l1.
(The format of our PDB-style files is described here.)

Timeline for d4r90l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4r90l2
View in 3D
Domains from other chains:
(mouse over for more information)
d4r90h_