Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Llama glama [TaxId:9844] [271448] (2 PDB entries) |
Domain d4r90l1: 4r90 L:3-110 [274263] Other proteins in same PDB: d4r90h_, d4r90l2 automated match to d3n9gl1 complexed with ca, gol |
PDB Entry: 4r90 (more details), 1.75 Å
SCOPe Domain Sequences for d4r90l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r90l1 b.1.1.0 (L:3-110) automated matches {Llama glama [TaxId: 9844]} vvtqepsltvspggtvtltcglksgsvtstnfptwyqqtpgqaprlliyntntrhsgvps rfsgsisenkaaltitgaqpedeaeyfcalfisnpsvefgggtqltvl
Timeline for d4r90l1: