| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Llama glama [TaxId:9844] [271450] (2 PDB entries) |
| Domain d4r90l2: 4r90 L:111-212 [274264] Other proteins in same PDB: d4r90h_, d4r90l1 automated match to d3n9gl2 complexed with ca, gol |
PDB Entry: 4r90 (more details), 1.75 Å
SCOPe Domain Sequences for d4r90l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r90l2 b.1.1.2 (L:111-212) automated matches {Llama glama [TaxId: 9844]}
sqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnkyaassylsltpeqwkshrsyscqvthegstvektvap
Timeline for d4r90l2: