Lineage for d4r90h_ (4r90 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744165Species Llama glama [TaxId:9844] [236993] (3 PDB entries)
  8. 2744166Domain d4r90h_: 4r90 H: [409529]
    Other proteins in same PDB: d4r90l1, d4r90l2
    automated match to d6shgh_
    complexed with ca, gol

Details for d4r90h_

PDB Entry: 4r90 (more details), 1.75 Å

PDB Description: anti cd70 llama glama fab 27b3
PDB Compounds: (H:) Anti CD70 Llama glama Fab 27B3 Heavy chain

SCOPe Domain Sequences for d4r90h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r90h_ b.1.1.1 (H:) automated matches {Llama glama [TaxId: 9844]}
evqlvesggglvqpggslrlscaasgftfsvyymnwvrqapgkglewvsdinneggttyy
adsvkgrftisrdnakntltlqmnslkpedtalyycvrdagysnhvpifdswgqgtqviv
asastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d4r90h_:

Click to download the PDB-style file with coordinates for d4r90h_.
(The format of our PDB-style files is described here.)

Timeline for d4r90h_:

  • d4r90h_ is new in SCOPe 2.08-stable