Lineage for d1cwla_ (1cwl A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113906Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
  4. 113907Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 113908Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 113914Protein Cyclophilin (eukaryotic) [50893] (7 species)
  7. 113921Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (33 PDB entries)
  8. 113925Domain d1cwla_: 1cwl A: [27423]

Details for d1cwla_

PDB Entry: 1cwl (more details), 1.8 Å

PDB Description: human cyclophilin a complexed with 4 4-hydroxy-meleu cyclosporin

SCOP Domain Sequences for d1cwla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwla_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1cwla_:

Click to download the PDB-style file with coordinates for d1cwla_.
(The format of our PDB-style files is described here.)

Timeline for d1cwla_: