Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (41 species) not a true protein |
Species Legionella pneumophila [TaxId:272624] [274202] (2 PDB entries) |
Domain d5byug_: 5byu G: [274209] automated match to d2o6ua_ complexed with coa |
PDB Entry: 5byu (more details), 2.4 Å
SCOPe Domain Sequences for d5byug_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5byug_ d.38.1.0 (G:) automated matches {Legionella pneumophila [TaxId: 272624]} inkiihkktfdiawgdmdalghvnnaryfdyfqearidwlreldikmtgqtgpvvihvac tflkpivypatvtihskvnslgnssmimdhdlyqeetlmaqgvskivwidytqnksvplp diirnlv
Timeline for d5byug_: