Lineage for d5byud_ (5byu D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551373Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2551374Protein automated matches [190143] (41 species)
    not a true protein
  7. 2551486Species Legionella pneumophila [TaxId:272624] [274202] (2 PDB entries)
  8. 2551490Domain d5byud_: 5byu D: [274203]
    automated match to d2o6ua_
    complexed with coa

Details for d5byud_

PDB Entry: 5byu (more details), 2.4 Å

PDB Description: crystal structure of unnamed thioesterase ipg2867 from legionella pneumophila
PDB Compounds: (D:) thioesterase

SCOPe Domain Sequences for d5byud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5byud_ d.38.1.0 (D:) automated matches {Legionella pneumophila [TaxId: 272624]}
hkktfdiawgdmdalghvnnaryfdyfqearidwlreldikmtgqtgpvvihvactflkp
ivypatvtihskvnslgnssmimdhdlyqeetlmaqgvskivw

SCOPe Domain Coordinates for d5byud_:

Click to download the PDB-style file with coordinates for d5byud_.
(The format of our PDB-style files is described here.)

Timeline for d5byud_: