SCOPe 2.06: Domain d4tlfb_: 4tlf B:

Lineage for d4tlfb_ (4tlf B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
   Pfam PF05995, CDO_I

6. Protein automated matches [191276] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189874] (2 PDB entries)

8. Domain d4tlfb_: 4tlf B: [273913]
   automated match to d3ussa_
   complexed with fe2

Details for d4tlfb_

PDB Entry: 4tlf, 2.14 Å

PDB Description: crystal structure of thiol dioxygenase from pseudomonas aeruginosa

PDB Compounds: (B:) Thiol dioxygenase

SCOPe Domain Sequences for d4tlfb_:

Sequence; same for both SEQRES and ATOM records:

>d4tlfb_ b.82.1.19 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
lrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqryqqyl
lhvdsrqrfsvvsfvwgpgqitpvhdhrvwgligmlrgaeysqpyafdaggrphpsgarr
rlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpfisgy
snsrlpniwdlsk

Timeline for d4tlfb_:

• d4tlfb_ first appeared in SCOPe 2.05
  
• d4tlfb_ appears in SCOPe 2.07
  
• d4tlfb_ appears in the current release, SCOPe 2.08