|  | Class b: All beta proteins [48724] (177 folds) | 
|  | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology | 
|  | Superfamily b.82.1: RmlC-like cupins [51182] (25 families)  | 
|  | Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins) Pfam PF05995, CDO_I | 
|  | Protein automated matches [191276] (3 species) not a true protein | 
|  | Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189874] (2 PDB entries) | 
|  | Domain d3ussa_: 3uss A: [186393] automated match to d2gm6a1 complexed with cl, fe2, na, so4 | 
PDB Entry: 3uss (more details), 2.7 Å
SCOPe Domain Sequences for d3ussa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ussa_ b.82.1.19 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
silrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqryqq
yllhvdsrqrfsvvsfvwgpgqitpvhdhrvwgligmlrgaeysqpyafdaggrphpsga
rrrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpfis
gysnsrlpniwdlske
Timeline for d3ussa_: