Lineage for d3ussa_ (3uss A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 962885Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 963325Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 963338Protein automated matches [191276] (1 species)
    not a true protein
  7. 963339Species Pseudomonas aeruginosa [TaxId:208964] [189874] (1 PDB entry)
  8. 963340Domain d3ussa_: 3uss A: [186393]
    automated match to d2gm6a1
    complexed with cl, fe2, na, so4

Details for d3ussa_

PDB Entry: 3uss (more details), 2.7 Å

PDB Description: Crystal structure of Cysteine dioxygenase from Pseudomonas aeruginosa
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3ussa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ussa_ b.82.1.19 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
silrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqryqq
yllhvdsrqrfsvvsfvwgpgqitpvhdhrvwgligmlrgaeysqpyafdaggrphpsga
rrrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpfis
gysnsrlpniwdlske

SCOPe Domain Coordinates for d3ussa_:

Click to download the PDB-style file with coordinates for d3ussa_.
(The format of our PDB-style files is described here.)

Timeline for d3ussa_: