| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
| Family a.73.1.0: automated matches [227254] (1 protein) not a true family |
| Protein automated matches [227039] (3 species) not a true protein |
| Species Bovine leukemia virus [TaxId:11901] [273631] (3 PDB entries) |
| Domain d4ph2b_: 4ph2 B: [273634] automated match to d1g03a_ complexed with gol, so4 |
PDB Entry: 4ph2 (more details), 1.44 Å
SCOPe Domain Sequences for d4ph2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ph2b_ a.73.1.0 (B:) automated matches {Bovine leukemia virus [TaxId: 11901]}
piisegnrnrhrawalrelqdikkeienkapgsqvwiqtlrlailqadptpadleqlcqy
iaspvdqtahmtsltaaiaaaeaantlqgfnpqngtltqqsaqpnagdlrsqyqnlwlqa
wknlptr
Timeline for d4ph2b_: