Lineage for d4ph2b_ (4ph2 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2718058Family a.73.1.0: automated matches [227254] (1 protein)
    not a true family
  6. 2718059Protein automated matches [227039] (3 species)
    not a true protein
  7. 2718060Species Bovine leukemia virus [TaxId:11901] [273631] (3 PDB entries)
  8. 2718062Domain d4ph2b_: 4ph2 B: [273634]
    automated match to d1g03a_
    complexed with gol, so4

Details for d4ph2b_

PDB Entry: 4ph2 (more details), 1.44 Å

PDB Description: mature n-terminal domain of capsid protein from bovine leukemia virus
PDB Compounds: (B:) BLV capsid - N-terminal domain

SCOPe Domain Sequences for d4ph2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ph2b_ a.73.1.0 (B:) automated matches {Bovine leukemia virus [TaxId: 11901]}
piisegnrnrhrawalrelqdikkeienkapgsqvwiqtlrlailqadptpadleqlcqy
iaspvdqtahmtsltaaiaaaeaantlqgfnpqngtltqqsaqpnagdlrsqyqnlwlqa
wknlptr

SCOPe Domain Coordinates for d4ph2b_:

Click to download the PDB-style file with coordinates for d4ph2b_.
(The format of our PDB-style files is described here.)

Timeline for d4ph2b_: