SCOPe 2.07: Domain d4ydkl2: 4ydk L:107-214

Lineage for d4ydkl2 (4ydk L:107-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d4ydkl2: 4ydk L:107-214 [273530]
   Other proteins in same PDB: d4ydkl1
   automated match to d1dn0a2
   complexed with gol, nag, nhe, peg

Details for d4ydkl2

PDB Entry: 4ydk, 2.05 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody c38- vrc16.01 in complex with hiv-1 clade ae strain 93th057 gp120

PDB Compounds: (L:) light chain of antibody c38-vrc16.01

SCOPe Domain Sequences for d4ydkl2:

Sequence; same for both SEQRES and ATOM records:

>d4ydkl2 b.1.1.2 (L:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d4ydkl2:

• d4ydkl2 first appeared in SCOPe 2.05
  
• d4ydkl2 appears in SCOPe 2.06
  
• d4ydkl2 appears in the current release, SCOPe 2.08