PDB entry 4ydk

View 4ydk on RCSB PDB site
Description: Crystal structure of broadly and potently neutralizing antibody C38-VRC16.01 in complex with HIV-1 clade AE strain 93TH057 gp120
Class: immune system
Keywords: Antibody, HIV-1, IMMUNE SYSTEM
Deposited on 2015-02-22, released 2015-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-17, with a file datestamp of 2015-06-12.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: Envelope glycoprotein gp160,Envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: heavy chain of antibody c38-vrc16.01
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YDK (0-End)
  • Chain 'L':
    Compound: light chain of antibody c38-vrc16.01
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YDK (0-213)
    Domains in SCOPe 2.07: d4ydkl1, d4ydkl2
  • Heterogens: NAG, PEG, GOL, NHE, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ydkL (L:)
diqmtqspsslsasigdrvtitcrasqdianylnwyqkksgtppkllifgatnlhhgvsp
rfsgsghgthfsltitnvqhedfanyfcqqsfqtvgsfgqgtwvdirrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgec