Lineage for d4xheg1 (4xhe G:1-207)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428807Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2428808Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2429246Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2429247Protein automated matches [193506] (5 species)
    not a true protein
  7. 2429248Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. 2429385Domain d4xheg1: 4xhe G:1-207 [273476]
    Other proteins in same PDB: d4xhea2, d4xheb2, d4xhec2, d4xhed2, d4xhee2, d4xhef2, d4xheg2, d4xheh2, d4xhei2, d4xhej2
    automated match to d2wnje_
    complexed with 40p, ca, cl

Details for d4xheg1

PDB Entry: 4xhe (more details), 1.9 Å

PDB Description: crystal structure of a-achbp in complex with pinnatoxin a
PDB Compounds: (G:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d4xheg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xheg1 b.96.1.0 (G:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d4xheg1:

Click to download the PDB-style file with coordinates for d4xheg1.
(The format of our PDB-style files is described here.)

Timeline for d4xheg1: