Class b: All beta proteins [48724] (178 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (5 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries) |
Domain d4xheh1: 4xhe H:1-208 [273469] Other proteins in same PDB: d4xhea2, d4xheb2, d4xhec2, d4xhed2, d4xhee2, d4xhef2, d4xheg2, d4xheh2, d4xhei2, d4xhej2 automated match to d2wnje_ complexed with 40p, ca, cl |
PDB Entry: 4xhe (more details), 1.9 Å
SCOPe Domain Sequences for d4xheh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xheh1 b.96.1.0 (H:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat qtrqvqhysccpepyidvnlvvkfrerr
Timeline for d4xheh1: