Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.0: automated matches [191553] (1 protein) not a true family |
Protein automated matches [190955] (7 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [273451] (2 PDB entries) |
Domain d4uiba1: 4uib A:6-308 [273454] Other proteins in same PDB: d4uiba2 automated match to d1pytb_ complexed with act, gol, gwx, zn |
PDB Entry: 4uib (more details), 1.94 Å
SCOPe Domain Sequences for d4uiba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uiba1 c.56.5.0 (A:6-308) automated matches {Pig (Sus scrofa) [TaxId: 9823]} ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd cgiharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn nlssikaylsihsysqhivypysydyklpennaelnnlakaavkelatlygtkytygpga ttlylapgggddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv lghl
Timeline for d4uiba1: