Lineage for d4uiba1 (4uib A:6-308)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2890040Family c.56.5.0: automated matches [191553] (1 protein)
    not a true family
  6. 2890041Protein automated matches [190955] (7 species)
    not a true protein
  7. 2890058Species Pig (Sus scrofa) [TaxId:9823] [273451] (2 PDB entries)
  8. 2890059Domain d4uiba1: 4uib A:6-308 [273454]
    Other proteins in same PDB: d4uiba2
    automated match to d1pytb_
    complexed with act, gol, gwx, zn

Details for d4uiba1

PDB Entry: 4uib (more details), 1.94 Å

PDB Description: crystal structure of 3p in complex with tafcpb
PDB Compounds: (A:) carboxypeptidase b

SCOPe Domain Sequences for d4uiba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uiba1 c.56.5.0 (A:6-308) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
cgiharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
nlssikaylsihsysqhivypysydyklpennaelnnlakaavkelatlygtkytygpga
ttlylapgggddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
lghl

SCOPe Domain Coordinates for d4uiba1:

Click to download the PDB-style file with coordinates for d4uiba1.
(The format of our PDB-style files is described here.)

Timeline for d4uiba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4uiba2