Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries) |
Domain d5aisa1: 5ais A:2-75 [273407] Other proteins in same PDB: d5aisa2, d5aisb2, d5aisc2, d5aisd2 automated match to d2cvda2 complexed with cwc, gsh, mg |
PDB Entry: 5ais (more details), 1.85 Å
SCOPe Domain Sequences for d5aisa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aisa1 c.47.1.0 (A:2-75) automated matches {Human (Homo sapiens) [TaxId: 9606]} pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl hqslaiaryltknt
Timeline for d5aisa1: