Lineage for d2rtob_ (2rto B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1133645Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1133646Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1133647Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1133670Protein Streptavidin [50878] (1 species)
  7. 1133671Species Streptomyces avidinii [TaxId:1895] [50879] (120 PDB entries)
  8. 1133771Domain d2rtob_: 2rto B: [27297]
    complexed with imi

Details for d2rtob_

PDB Entry: 2rto (more details), 1.58 Å

PDB Description: streptavidin-2-iminobiotin complex, ph 2.6, space group i222
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d2rtob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rtob_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOPe Domain Coordinates for d2rtob_:

Click to download the PDB-style file with coordinates for d2rtob_.
(The format of our PDB-style files is described here.)

Timeline for d2rtob_: