SCOPe 2.03: Domain d2rtob_: 2rto B:

Lineage for d2rtob_ (2rto B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (122 PDB entries)

8. Domain d2rtob_: 2rto B: [27297]
   complexed with imi

Details for d2rtob_

PDB Entry: 2rto, 1.58 Å

PDB Description: streptavidin-2-iminobiotin complex, ph 2.6, space group i222

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d2rtob_:

Sequence; same for both SEQRES and ATOM records:

>d2rtob_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Timeline for d2rtob_:

• d2rtob_ first appeared (with stable ids) in SCOP 1.55
  
• d2rtob_ appears in SCOPe 2.02
  
• d2rtob_ appears in SCOPe 2.04
  
• d2rtob_ appears in the current release, SCOPe 2.08