Lineage for d4oq0a_ (4oq0 A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619196Protein automated matches [190161] (30 species)
    not a true protein
  7. 2619286Species Escherichia coli [TaxId:562] [187306] (106 PDB entries)
  8. 2619390Domain d4oq0a_: 4oq0 A: [272871]
    automated match to d4ibra_
    complexed with 2ul, ca, edo, peg; mutant

Details for d4oq0a_

PDB Entry: 4oq0 (more details), 1.42 Å

PDB Description: crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s/g238s mutation in complex with boron-based inhibitor ec25
PDB Compounds: (A:) TEM-94 ES-beta-lactamase

SCOPe Domain Sequences for d4oq0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oq0a_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldswepelneaipnderdtttpvamattlrklltgelltaasrq
qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviymtg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d4oq0a_:

Click to download the PDB-style file with coordinates for d4oq0a_.
(The format of our PDB-style files is described here.)

Timeline for d4oq0a_: