Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein automated matches [190161] (30 species) not a true protein |
Species Escherichia coli [TaxId:562] [187306] (106 PDB entries) |
Domain d4ibra_: 4ibr A: [196859] automated match to d1jwva_ complexed with ca, mes; mutant |
PDB Entry: 4ibr (more details), 2.2 Å
SCOPe Domain Sequences for d4ibra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ibra_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd agqeqlgrrihysqndlvkyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp keltaflhnmgdhvtrldrwepelneaipnderdtttpvamattlrklltgelltaasrq qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviymtg sqatmdernrqiaeigaslikhw
Timeline for d4ibra_: