SCOPe 2.06: Domain d4zhza1: 4zhz A:1-196

Lineage for d4zhza1 (4zhz A:1-196)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (5 species)

7. Species Influenza a virus (strain a/puerto rico/8/1934 h1n1) [TaxId:211044] [272056] (5 PDB entries)

8. Domain d4zhza1: 4zhz A:1-196 [272794]
   Other proteins in same PDB: d4zhza2
   automated match to d4e5ed_
   complexed with 4p8, mn, so4

Details for d4zhza1

PDB Entry: 4zhz, 2.5 Å

PDB Description: endonuclease inhibitor bound to influenza strain h1n1 polymerase acidic subunit n-terminal region with expelling one of the metal ions in the active site

PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d4zhza1:

Sequence; same for both SEQRES and ATOM records:

>d4zhza1 c.52.1.34 (A:1-196) PA N-terminal domain {Influenza a virus (strain a/puerto rico/8/1934 h1n1) [TaxId: 211044]}
medfvrqcfnpmivelaektmkeygedlkietnkfaaicthlevcfmysdaskhrfeiie
grdrtmawtvvnsicnttgaekpkflpdlydykenrfieigvtrrevhiyylekankiks
ekthihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqser

Timeline for d4zhza1:

• d4zhza1 first appeared in SCOPe 2.05, called d4zhza_
  
• d4zhza1 appears in SCOPe 2.07
  
• d4zhza1 appears in the current release, SCOPe 2.08