Lineage for d1vwjb_ (1vwj B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113687Fold b.61: Streptavidin-like [50875] (4 superfamilies)
  4. 113688Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 113689Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 113704Protein Streptavidin [50878] (1 species)
  7. 113705Species Streptomyces avidinii [TaxId:1895] [50879] (85 PDB entries)
  8. 113745Domain d1vwjb_: 1vwj B: [27268]

Details for d1vwjb_

PDB Entry: 1vwj (more details), 1.45 Å

PDB Description: streptavidin-cyclo-[5-s-valeramide-hpqgppc]k-nh2, ph 2.5, i222 complex

SCOP Domain Sequences for d1vwjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vwjb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOP Domain Coordinates for d1vwjb_:

Click to download the PDB-style file with coordinates for d1vwjb_.
(The format of our PDB-style files is described here.)

Timeline for d1vwjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vwjd_