Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins) |
Protein automated matches [271870] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [271874] (64 PDB entries) |
Domain d5am2a2: 5am2 A:228-547 [272639] Other proteins in same PDB: d5am2a1 automated match to d3i28a2 complexed with dms, kuf, peg, so4 |
PDB Entry: 5am2 (more details), 1.7 Å
SCOPe Domain Sequences for d5am2a2:
Sequence, based on SEQRES records: (download)
>d5am2a2 c.69.1.11 (A:228-547) automated matches {Human (Homo sapiens) [TaxId: 9606]} lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq mdkptevnqilikwldsdar
>d5am2a2 c.69.1.11 (A:228-547) automated matches {Human (Homo sapiens) [TaxId: 9606]} lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks lfrasdesvlvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmer nwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkp tevnqilikwldsdar
Timeline for d5am2a2: