SCOPe 2.07: Domain d5akza2: 5akz A:228-547

Lineage for d5akza2 (5akz A:228-547)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)

6. Protein automated matches [271870] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [271874] (64 PDB entries)

8. Domain d5akza2: 5akz A:228-547 [272573]
   Other proteins in same PDB: d5akza1
   automated match to d3i28a2
   complexed with 6nx, gol, so4

Details for d5akza2

PDB Entry: 5akz, 2.18 Å

PDB Description: ligand complex structure of soluble epoxide hydrolase

PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d5akza2:

Sequence; same for both SEQRES and ATOM records:

>d5akza2 c.69.1.11 (A:228-547) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr
vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf
ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks
lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr
nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq
mdkptevnqilikwldsdar

Timeline for d5akza2:

• d5akza2 first appeared in SCOPe 2.05
  
• d5akza2 appears in SCOPe 2.06
  
• d5akza2 appears in the current release, SCOPe 2.08