Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein automated matches [190393] (13 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255271] (6 PDB entries) |
Domain d4yxwb2: 4yxw B:95-379 [272511] Other proteins in same PDB: d4yxwa1, d4yxwa3, d4yxwb1, d4yxwb3, d4yxwc1, d4yxwc3, d4yxwd1, d4yxwd3, d4yxwe1, d4yxwe3, d4yxwf1, d4yxwf3, d4yxwh1, d4yxwh2, d4yxwi_ automated match to d1maba3 complexed with anp, cl, mg, na, ts6 |
PDB Entry: 4yxw (more details), 3.1 Å
SCOPe Domain Sequences for d4yxwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yxwb2 c.37.1.11 (B:95-379) automated matches {Cow (Bos taurus) [TaxId: 9913]} vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq
Timeline for d4yxwb2: