Lineage for d4y2ta2 (4y2t A:228-547)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508005Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)
  6. 2508019Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species)
  7. 2508020Species Human (Homo sapiens) [TaxId:9606] [102626] (41 PDB entries)
  8. 2508057Domain d4y2ta2: 4y2t A:228-547 [272460]
    Other proteins in same PDB: d4y2ta1
    automated match to d3i28a2
    complexed with 49q, mg

Details for d4y2ta2

PDB Entry: 4y2t (more details), 2.4 Å

PDB Description: structure of soluble epoxide hydrolase in complex with 3-[4- (benzyloxy)phenyl]propan-1-ol
PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d4y2ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y2ta2 c.69.1.11 (A:228-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr
vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf
ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks
lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr
nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq
mdkptevnqilikwldsdar

SCOPe Domain Coordinates for d4y2ta2:

Click to download the PDB-style file with coordinates for d4y2ta2.
(The format of our PDB-style files is described here.)

Timeline for d4y2ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4y2ta1