Lineage for d4pc6d3 (4pc6 D:140-279)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945956Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
    beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123
  4. 2945957Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) (S)
    comprises two structural repeats of this fold
  5. 2945958Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (2 proteins)
  6. 2945959Protein Elongation factor Ts (EF-Ts), dimerisation domain, C-terminal domain [419041] (2 species)
  7. 2945960Species Escherichia coli [TaxId:562] [419525] (6 PDB entries)
    species duplication: consists of two subdomains of this fold
  8. 2945968Domain d4pc6d3: 4pc6 D:140-279 [272286]
    Other proteins in same PDB: d4pc6a1, d4pc6a2, d4pc6a3, d4pc6b1, d4pc6b2, d4pc6b3, d4pc6c1, d4pc6c2, d4pc6d1, d4pc6d2
    automated match to d1efub2
    complexed with gnp, gol

    has additional insertions and/or extensions that are not grouped together

Details for d4pc6d3

PDB Entry: 4pc6 (more details), 2.2 Å

PDB Description: elongation factor tu:ts complex with bound gdpnp
PDB Compounds: (D:) elongation factor ts

SCOPe Domain Sequences for d4pc6d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pc6d3 d.43.1.1 (D:140-279) Elongation factor Ts (EF-Ts), dimerisation domain, C-terminal domain {Escherichia coli [TaxId: 562]}
dvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikpedvsaevvekeyqvqld
iamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvgqllkehnaevtgfirfe
vgegiekvetdfaaevaams

SCOPe Domain Coordinates for d4pc6d3:

Click to download the PDB-style file with coordinates for d4pc6d3.
(The format of our PDB-style files is described here.)

Timeline for d4pc6d3: