Lineage for d4pc6d3 (4pc6 D:140-279)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903540Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
    beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123
  4. 1903541Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) (S)
    comprises two structural repeats of this fold
  5. 1903542Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)
  6. 1903543Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species)
  7. 1903547Species Escherichia coli [TaxId:562] [54716] (6 PDB entries)
    duplication: consists of two subdomains of this fold
  8. 1903563Domain d4pc6d3: 4pc6 D:140-279 [272286]
    Other proteins in same PDB: d4pc6a1, d4pc6a2, d4pc6a3, d4pc6b1, d4pc6b2, d4pc6b3, d4pc6c1, d4pc6d1
    automated match to d1efub2
    complexed with gnp, gol

Details for d4pc6d3

PDB Entry: 4pc6 (more details), 2.2 Å

PDB Description: elongation factor tu:ts complex with bound gdpnp
PDB Compounds: (D:) elongation factor ts

SCOPe Domain Sequences for d4pc6d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pc6d3 d.43.1.1 (D:140-279) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]}
dvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikpedvsaevvekeyqvqld
iamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvgqllkehnaevtgfirfe
vgegiekvetdfaaevaams

SCOPe Domain Coordinates for d4pc6d3:

Click to download the PDB-style file with coordinates for d4pc6d3.
(The format of our PDB-style files is described here.)

Timeline for d4pc6d3: