Lineage for d4pc6b2 (4pc6 B:205-296)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793298Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2793299Protein automated matches [226946] (29 species)
    not a true protein
  7. 2793340Species Escherichia coli [TaxId:316385] [272315] (3 PDB entries)
  8. 2793344Domain d4pc6b2: 4pc6 B:205-296 [272316]
    Other proteins in same PDB: d4pc6a1, d4pc6a3, d4pc6b1, d4pc6b3, d4pc6c1, d4pc6c2, d4pc6c3, d4pc6d1, d4pc6d2, d4pc6d3
    automated match to d1efca1
    complexed with gnp, gol

Details for d4pc6b2

PDB Entry: 4pc6 (more details), 2.2 Å

PDB Description: elongation factor tu:ts complex with bound gdpnp
PDB Compounds: (B:) elongation factor tu

SCOPe Domain Sequences for d4pc6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pc6b2 b.43.3.0 (B:205-296) automated matches {Escherichia coli [TaxId: 316385]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d4pc6b2:

Click to download the PDB-style file with coordinates for d4pc6b2.
(The format of our PDB-style files is described here.)

Timeline for d4pc6b2: