Lineage for d1opab_ (1opa B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232449Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 232450Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
    bind hydrophobic ligands in their interior
  5. 232615Family b.60.1.2: Fatty acid binding protein-like [50847] (13 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 232654Protein Cellular retinol-binding protein II (CRBP) [50864] (2 species)
  7. 232655Species Rat (Rattus norvegicus) [TaxId:10116] [50865] (7 PDB entries)
  8. 232657Domain d1opab_: 1opa B: [27215]

Details for d1opab_

PDB Entry: 1opa (more details), 1.9 Å

PDB Description: the crystal structures of holo-and apo-cellular retinol binding protein ii

SCOP Domain Sequences for d1opab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opab_ b.60.1.2 (B:) Cellular retinol-binding protein II (CRBP) {Rat (Rattus norvegicus)}
tkdqngtwemesnenfegymkaldidfatrkiavrltqtkiivqdgdnfktktnstfrny
dldftvgvefdehtkgldgrnvktlvtwegntlvcvqkgekenrgwkqwvegdklylelt
cgdqvcrqvfkkk

SCOP Domain Coordinates for d1opab_:

Click to download the PDB-style file with coordinates for d1opab_.
(The format of our PDB-style files is described here.)

Timeline for d1opab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1opaa_