Class b: All beta proteins [48724] (177 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [259757] (10 PDB entries) |
Domain d5afke_: 5afk E: [272149] automated match to d4uxua_ complexed with 5vu, gol, l0b |
PDB Entry: 5afk (more details), 2.46 Å
SCOPe Domain Sequences for d5afke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5afke_ b.96.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr serfyecckepypdvtftvtfrkkg
Timeline for d5afke_:
View in 3D Domains from other chains: (mouse over for more information) d5afka_, d5afkb_, d5afkc_, d5afkd_ |