PDB entry 5afk

View 5afk on RCSB PDB site
Description: alpha7-AChBP in complex with lobeline and fragment 2
Class: transport protein
Keywords: transport protein, pentameric ligand-gated ion channels, cys-loop receptor, nicotinic acetylcholine receptor, allosteric modulation, drug discovery
Deposited on 2015-01-22, released 2015-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFK (0-204)
    Domains in SCOPe 2.06: d5afka_
  • Chain 'B':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFK (0-204)
    Domains in SCOPe 2.06: d5afkb_
  • Chain 'C':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFK (0-204)
    Domains in SCOPe 2.06: d5afkc_
  • Chain 'D':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFK (0-204)
    Domains in SCOPe 2.06: d5afkd_
  • Chain 'E':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFK (0-204)
    Domains in SCOPe 2.06: d5afke_
  • Heterogens: L0B, GOL, 5VU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afkA (A:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afkB (B:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afkC (C:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afkD (D:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afkE (E:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg