Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein automated matches [190236] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188722] (49 PDB entries) |
Domain d4zbfh1: 4zbf H:172-321 [272110] Other proteins in same PDB: d4zbfa2, d4zbfb2, d4zbfc2, d4zbfd2, d4zbfe2, d4zbff2, d4zbfg2, d4zbfh2, d4zbfi2, d4zbfj2, d4zbfk2, d4zbfl2 automated match to d2mhsa_ complexed with 4m7 |
PDB Entry: 4zbf (more details), 2.2 Å
SCOPe Domain Sequences for d4zbfh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zbfh1 f.1.4.1 (H:172-321) automated matches {Human (Homo sapiens) [TaxId: 9606]} delyrqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqgm lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla esitdvlvrtkrdwlvkqrgwdgfveffhv
Timeline for d4zbfh1: