SCOP 1.63: Domain d1bm5__: 1bm5 -

Lineage for d1bm5__ (1bm5 -)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (3 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (13 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (7 PDB entries)

8. Domain d1bm5__: 1bm5 - [27207]
   mutant

Details for d1bm5__

PDB Entry: 1bm5

PDB Description: the solution structure of a site-directed mutant (r111m) of human cellular retionic acid binding protein-type ii, nmr, 31 structures

SCOP Domain Sequences for d1bm5__:

Sequence; same for both SEQRES and ATOM records:

>d1bm5__ b.60.1.2 (-) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtmeltndgeli
ltmtaddvvctrvyvre

Timeline for d1bm5__:

• d1bm5__ first appeared (with stable ids) in SCOP 1.55
  
• d1bm5__ appears in SCOP 1.61
  
• d1bm5__ appears in SCOP 1.65
  
• d1bm5__ appears in the current release, SCOPe 2.08, called d1bm5a_