Lineage for d1xcaa_ (1xca A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1324658Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1324706Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 1324713Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (30 PDB entries)
  8. 1324755Domain d1xcaa_: 1xca A: [27205]

Details for d1xcaa_

PDB Entry: 1xca (more details), 2.3 Å

PDB Description: apo-cellular retinoic acid binding protein ii
PDB Compounds: (A:) cellular retinoic acid binding protein type II

SCOPe Domain Sequences for d1xcaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcaa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtmeltndgeli
ltmtaddvvctrvyvre

SCOPe Domain Coordinates for d1xcaa_:

Click to download the PDB-style file with coordinates for d1xcaa_.
(The format of our PDB-style files is described here.)

Timeline for d1xcaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xcab_