PDB entry 1xca

View 1xca on RCSB PDB site
Description: apo-cellular retinoic acid binding protein II
Class: retinoic acid transport
Keywords: retinoic acid transport, crabpii, retinoic acid, ligand entry, vitamin a
Deposited on 1996-12-31, released 1998-07-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellular retinoic acid binding protein type II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered (110)
    Domains in SCOPe 2.03: d1xcaa_
  • Chain 'B':
    Compound: cellular retinoic acid binding protein type II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered (110)
    Domains in SCOPe 2.03: d1xcab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xcaA (A:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtmeltndgeli
    ltmtaddvvctrvyvre
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xcaB (B:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtmeltndgeli
    ltmtaddvvctrvyvre