Lineage for d1xcaa_ (1xca A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16579Family b.60.1.2: Fatty acid binding protein-like [50847] (10 proteins)
  6. 16596Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 16603Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (7 PDB entries)
  8. 16608Domain d1xcaa_: 1xca A: [27205]

Details for d1xcaa_

PDB Entry: 1xca (more details), 2.3 Å

PDB Description: apo-cellular retinoic acid binding protein ii

SCOP Domain Sequences for d1xcaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcaa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtmeltndgeli
ltmtaddvvctrvyvre

SCOP Domain Coordinates for d1xcaa_:

Click to download the PDB-style file with coordinates for d1xcaa_.
(The format of our PDB-style files is described here.)

Timeline for d1xcaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xcab_