SCOPe 2.06: Domain d4rw8a1: 4rw8 A:1-429

Lineage for d4rw8a1 (4rw8 A:1-429)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein automated matches [190211] (6 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225820] (18 PDB entries)

8. Domain d4rw8a1: 4rw8 A:1-429 [271960]
   Other proteins in same PDB: d4rw8a2, d4rw8a3, d4rw8b_
   automated match to d2ykna1
   complexed with 3x6

Details for d4rw8a1

PDB Entry: 4rw8, 2.88 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with (e)- 3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy) phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor'

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H, p66 subunit

SCOPe Domain Sequences for d4rw8a1:

Sequence; same for both SEQRES and ATOM records:

>d4rw8a1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d4rw8a1:

• d4rw8a1 first appeared in SCOPe 2.05
  
• d4rw8a1 appears in SCOPe 2.07
  
• d4rw8a1 appears in the current release, SCOPe 2.08