![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Spore coat protein A, CotA, N- and C-terminal domain [418912] (2 species) |
![]() | Species Bacillus subtilis [TaxId:224308] [419336] (8 PDB entries) |
![]() | Domain d4q8bb3: 4q8b B:357-512 [271940] Other proteins in same PDB: d4q8ba2, d4q8bb2 automated match to d3zdwa3 complexed with cl, cu, mg, oxy, pge, sxx |
PDB Entry: 4q8b (more details), 1.91 Å
SCOPe Domain Sequences for d4q8bb3:
Sequence, based on SEQRES records: (download)
>d4q8bb3 b.6.1.3 (B:357-512) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 224308]} sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr iaatfgpysgryvwhchilehedydmmrpmditdph
>d4q8bb3 b.6.1.3 (B:357-512) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 224308]} sypqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthpihl hlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaatfgp ysgryvwhchilehedydmmrpmditdph
Timeline for d4q8bb3: